table.go 144 KB
Newer Older
// generated by go run gen.go; DO NOT EDIT

package publicsuffix

ale's avatar
ale committed
const version = "'s public_suffix_list.dat, git revision 792f13d38c795cf910de96de4baac48f1fee3162 (2021-08-23T07:37:32Z)"

const (
	nodesBitsChildren   = 10
	nodesBitsICANN      = 1
	nodesBitsTextOffset = 15
	nodesBitsTextLength = 6

	childrenBitsWildcard = 1
	childrenBitsNodeType = 2
	childrenBitsHi       = 14
	childrenBitsLo       = 14

const (
	nodeTypeNormal     = 0
	nodeTypeException  = 1
	nodeTypeParentOnly = 2

// numTLD is the number of top level domains.
ale's avatar
ale committed
const numTLD = 1508

// Text is the combined text of all labels.
ale's avatar
ale committed
const text = "9guacuiababia-goracleaningroks-theatree164-balsfjordd-dnshome-we" +
	"bserverdal-o-g-i-n4t3l3p0rtashkentatamotorsitestinggfarmerseinea" +
	"stasiaetnaamesjevuemielnoboribetsucks3-ap-northeast-2ix4432-bals" +
	"an-suedtirolkuszczytnoopencraftrainingdyniabruzzoologicalabamaga" +
	"sakishimabaraogashimadachicagoboats3-ap-northeast-1kappchizip611" +
	"6-b-datacentermezproxyzgorabogadobeaemcloud-fr1337birdartcenterp" +
	"risecloudaccesscambridgeiseiroumuencheninohekinannestaditchyouri" +
	"parachutingleezebirkenesoddtangenovaranzanquannefrankfurtcmember" +
	"s3-website-ap-southeast-2birthplacebitbucketrzyninomiyakonojorpe" +
	"landivtasvuodnakamagayahooguyurihonjournalistjohnirasakin-vpncas" +
	"inord-odalombardynalias3-website-eu-west-1bjarkoyusuharabjerkrei" +
	"mbamblebesbyenvironmentalconservationionjukudoyamaintenancebizen" +
	"akanojohanamakinoharaustinnaumburgjerdrumcpeatonsbergjerstadotsu" +
	"ruokakamigaharamswatch-and-clockerevistarnbergivestbytemark12bju" +
	"gnieznord-frontierblackfridayusuisservehttpbin-butterbloombergba" +
	"uernishiazaincheonishigovtcp4bloxcms3-website-sa-east-1bluebitem" +
	"p-dnswedenishiharabmoattachments3-website-us-east-1bms3-website-" +
	"us-west-1bmwedeployuufcfanishiizunazukindianapolis-a-bloggerbnrw" +
	"egroweibolognagareyamakeuparaglidinglitcheltenham-radio-opensoci" +
	"alomzaporizhzhegurindianmarketingliwicebomloabathsbcateringebuil" +
	"dingloboavistanbulsan-sudtirolondonetskaratsuginamikatagamilanos" +
	"hiroomglogoweirbondigitaloceanographicsxboxfordellogliastradingl" +
	"oppenzaolbia-tempio-olbiatempioolbialystokkeliwebhostinglugsjcbn" +
	"pparibashkiriabonnishikatakazakindielddanuorrindigenaklodzkodair" +
	"abookinghostedpictetgoryuzawabookonlinewjerseyboomlajollamerican" +
	"expressexyboschaefflerdalondrinamsskoganeindowapblogsiteleafamil" +
	"ycompany-2bostik-serverrankoshigayachts3-website-us-west-2boston" +
	"akijinsekikogentappsselfiparisor-fronishikatsuragit-reposts-and-" +
	"telecommunicationsakyotanabellevuelosangelesjabbottjeldsundivtta" +
	"svuotnakamurataiwanairforcechireadthedocscbgmbhartipschlesisches" +
	"alangenishikawazukamisatohoboleslawieconomiastalowa-wolawabotani" +
	"calgardeno-stagingminakamichiharabotanicgardenishimerabotanycath" +
	"olicaxiaskimitsubatamibudejjuegoshikievennodesabaerobaticketsalo" +
	"n-1bouncemerckmsdnipropetrovskjervoyageometre-experts-comptables" +
	"altdalorenskogmodellingmxenishinomiyashironoddabounty-fullensake" +
	"rrypropertiesaludiyboutiquebecommerce-shopitsitempurlotteboutire" +
	"serve-onlinewmexicodyn-o-saurlandesalvadordalibabalena-devicesal" +
	"zburgretakamatsukawabozen-sudtirolottokonamegatakatsukindustriab" +
	"ozen-suedtirolouvrehabmerbplaceducatorprojectjmaxxxeroxfinitybra" +
	"ndywinevalleybrasiliabresciabrindisibenikikugawashtenawdevcdnacc" +
	"essobetsuitaijindustriesteamfamberkeleybristoloseyouriparliament" +
	"jomelhusgardenishinoomotegohtawaramotoineppubtlsamegawabritishco" +
	"lumbialowiezaganishinoshimatsunowruzhgorodeomniweatherchannelpus" +
	"ercontentjxjampalacebroadcastlebtimnetzjavaldaostathelleluxembou" +
	"rgrimstadrangedalublindesnesamnangerbroadwaybroke-itvedestrandra" +
	"y-dnstracebrokerbronnoysundrayddns5ybrothermesaverdealerbrowsers" +
	"afetymarketsampaleomurabrumunddalucaniabrunelastxn--0trq7p7nnish" +
	"iokoppegardraydnsupdaterbrusselsamsclubartowellbeingzonebruxelle" +
	"samsungripebryanskodjedugit-pagespeedmobilizeroticagliaricoharuh" +
	"rbrynewportkmaxxn--11b4c3drivegarsheiheijinfinitinsureggioemilia" +
	"romagnamsosnowiechernivtsiciliabuskerudrobaknoluoktachikawafflec" +
	"elluciancrmadviseharag-cloud-charitychyattorneyagawakayamagazine" +
	"kobayashikaoirmitakeharagusartsandnessjoenishitosashimizunaminam" +
	"ibosognebuzentsujiiebuzzlgriwataraidrrbwesteuropenairbusantiques" +
	"t-a-la-maisondre-landroidrudupontariobranconavstackareliancebzhi" +
	"tomirbzzwestfalenishiwakintelligencecoloradoplateaudiopsysanokar" +
	"umaifarsundyndns-homednsantabarbaracolumbusheycommunecommunity-p" +
	"rochowicecomobaracomparemarkerryhotelsantacruzsantafedjeffersonc" +
	"omsecaaskoyabearalvahkihokumakogenebakkeshibechambagriculturenne" +
	"bugattiffanyaarborteaches-yogasawaracingrpartinternationalfirear" +
	"msantamariakecondoshichinohealth-carereformemergencyahikobeardub" +
	"aiduckdnsncfdyndns-ipartsantoandreamhostersanukintuitoyosatoyoka" +
	"waconferenceconstructionconsuladoesntexisteingeekasaokamikitayam" +
	"atsurinuyamashinatsukigatakasagotpantheonsiteconsultanthropology" +
	"consultingruenoharacontactoyotapartycontagematsubaracontemporary" +
	"arteducationalchikugodogadollsaobernardocontractorskenconventure" +
	"shinodearthruherecifedexetercookingchannelsdvrdnsdojoburguidefen" +
	"seljordyndns-mailcoolcooperativano-frankivskygearappasadenarashi" +
	"nocopenhagencyclopedichofunatoriginstantcloudfrontdoorcoproducti" +
	"onsaogoncarriercorporationcorsicahcesuoloansaotomeiwamashikokuch" +
	"uocorvettenrissadonnagatorogersvp4cosenzakopanelblagrarchaeology" +
	"eongbuk0cosidnsfor-better-thanawatchesapporocostumedicaltanisset" +
	"taishinomakindlefrakkestadyndns-office-on-the-webercouchpotatofr" +
	"iesardegnaroycoukashibatakasugainvestmentsardiniacouncilcouponsa" +
	"rlcozoracqcxn--12cfi8ixb8lcranbrookuwanalyticsarpsborguitarsaruf" +
	"utsunomiyawakasaikaitabashijonawatecrdyndns-picsasayamatta-varjj" +
	"atoyotomiyazakinzais-a-candidatecreditcardyndns-remotewdyndns-se" +
	"rverisigncreditunioncremonashgabadaddjaguarqhachinohedmarkashiha" +
	"racrewhalingujoinvilleirvikashiwaracricketoyotsukaidocrimeast-ka" +
	"zakhstanangercrotonecrownipassagensasebofagemologicallynxn--12co" +
	"0c3b4evalled-aostamayufuettertdasnetzcrsaskatchewancruisesassari" +
	"s-a-caterercuisinellancashirecipescaracalvinklein-berlindaskvoll" +
	"pagesaudaculturalcentertainmentoyouracuneocupcakecuritibaghdadul" +
	"toystre-slidrettozawacurvalledaostaobaomoriguchiharahkkeravjuedi" +
	"schesapeakebayernuorochestercymruovatmallorcafederationcilla-spe" +
	"ziacyonabarumemorialcyouthachiojiyaizuwakamatsubushikusakadogawa" +
	"ferrarivneferrerotikagoshimalopolskanlandyndns-workshoparenakani" +
	"ikawatanagurafetsundyndns1fgushikamifuranordreisa-hockeynutsirac" +
	"usaintlouis-a-anarchistoireggio-emilia-romagnakatombetsumitakagi" +
	"izefhvalerfidoomdnsiskinkyotobetsulikes-piedmonticellocalzonefie" +
	"ldynnsauheradyndns-webhareidsbergentingulenfigueresinstagingwidd" +
	"leitungsenfilateliafilegear-audnedalnfilegear-dealstahaugesunder" +
	"seaportsinfolionetworkangerfilegear-gbizfilegear-iefilegear-jpmo" +
	"rganfilegear-sg-1filminamiechizenfinalfinancefineartschulefinlan" +
	"dynservebbsavannahgafinnoyfirebaseappatriafirenetrani-andria-bar" +
	"letta-trani-andriafirenzefirestonefirewebhopocznordre-landynulme" +
	"msettlersaveincloudyndns-wikirafirmdalegnicapebretonamicrolighti" +
	"ngxn--1ctwolominamatargithubusercontentraniandriabarlettatranian" +
	"driafishingokasellfylkesbiblackbaudcdn-edgestackhero-networkingg" +
	"roupowiathletajimageandsoundandvision-riopretochigiessensiositel" +
	"evision-webpaashorokanaiefitjarvodkagaminogatagajobojis-a-chefas" +
	"tly-terrariumetacentrumeteorappassenger-associationfitnessettlem" +
	"entranoyfjalerflekkefjordynv6flesbergflickragerokunohealthcareer" +
	"schulserverflirfloginlinefloraflorencefloridatsunanjoetsuwanouch" +
	"ikujogaszkolancasterfloripaderbornfloristanohatajimidsundynvpnpl" +
	"us-4floromskogflowerschwarzgwangjuifminamifuranowtvallee-aostero" +
	"yfltranslateflynnhosting-clusterfndyroyrvikingunmaniwakuratefnwk" +
	"asukabedzin-addrammenuniversityfoodnetworkdalfor-ourfor-somedio-" +
	"campidano-mediocampidanomediofor-theaterforexrothachirogatakamor" +
	"iokakudamatsueforgotdnschweizforli-cesena-forlicesenaforlikescan" +
	"dyn53forsalegoldpoint2thisamitsukeforsandasuoloftransportefortal" +
	"fortextileikangerfortmissoulanciafortworthadanore-og-uvdalfosnes" +
	"ciencecentersciencehistoryfotransurlfoxafozfranamizuhobby-sitefr" +
	"ancaiserniafranziskanerimaringatlantajiris-a-conservativegascien" +
	"tistordalfredrikstadtvscjohnsonfreeddnsfreebox-oscrapper-sitefre" +
	"edesktoppdalfreemasonryfreemyiphosteurovisionfreesitefreetlscrap" +
	"pingfreiburgfreseniusculturecreationfribourgfriuli-v-giuliafriul" +
	"i-ve-giuliafriuli-vegiuliafriuli-venezia-giuliafriuli-veneziagiu" +
	"liafriuli-vgiuliafriuliv-giuliafriulive-giuliafriulivegiuliafriu" +
	"livenezia-giuliafriuliveneziagiuliafriulivgiuliafrlfroganscrysec" +
	"uritytacticservehumourfrognfrolandfrom-akrehamnfrom-alfrom-arfro" +
	"m-azimuthatogayabukijobservableusercontentrapaniizafrom-capetown" +
	"news-stagingfrom-coffeedbackplaneappaviancargodaddyn-vpndnservei" +
	"rchonanbulsan-suedtirolucernefrom-ctravelchannelfrom-dchoseikaru" +
	"gamvikarlsoyfrom-deatnunjargafrom-flanderserveminecraftravelersi" +
	"nsurancefrom-gaulardalfrom-hichisodegaurafrom-iafrom-idfrom-ilfr" +
	"om-in-brbar1from-kservemp3from-kyowariasahikawafrom-langevagrige" +
	"ntomologyeonggiehtavuoatnabudapest-a-la-masion-rancherkasydneyfr" +
	"om-malselvendrelluciancrmadvancefrom-mdfrom-medizinhistorischese" +
	"rvep2pfizerfrom-mifunefrom-mnfrom-modalenfrom-mservepicservequak" +
	"efrom-mtnfrom-nctulanservesarcasmatartanddesignfrom-ndfrom-nefro" +
	"m-nhktrdfrom-njservicesevastopolefrom-nminamiiseoullensvanguardf" +
	"rom-nvallee-d-aosteigenfrom-nynysagaeroclubmedecincinnativeameri" +
	"canantiquest-mon-blogueurodirumaceratabuseating-organichoshibuya" +
	"habackyardsandvikcoromantovalle-daostavangerfrom-ohdattorelayfro" +
	"m-oketogolffansevenassisicilyfrom-orfrom-padoval-daostavalleyfro" +
	"m-pratogurafrom-ris-a-cpadualstackasumigaurayasudafrom-schoenbru" +
	"nnfrom-sdscloudfrom-tnfrom-txn--1lqs03nfrom-utazurestaticappspac" +
	"eusercontentrendhostingfrom-vald-aostarostwodzislawhoswholdingsm" +
	"all-webredirectmeeresistancefrom-vtrentin-sud-tirolfrom-wafrom-w" +
	"iardwebspacefrom-wvalleeaosteinkjerusalembroideryfrom-wyfrosinon" +
	"efrostaplesewienfroyaitakahamalvikasuyanaizuerichardlillesandefj" +
	"ordfruskydivingfstcgroupgfoggiafujiiderafujikawaguchikonefujimin" +
	"okamoenairguardiannakadomarinebraskaunicommbankaszubyfujinomiyad" +
	"attowebcampinashikiminohostfoldnavyfujiokayamamurogawafujisatosh" +
	"onairlinedre-eikerfujisawafujishiroishidakabiratoridebianfujitsu" +
	"rugashimandalfujiyoshidavvenjargap-northeast-3fukayabeatsharis-a" +
	"-cubicle-slavellinodeobjectsharpharmacienshawaiijimarburgfukuchi" +
	"yamadavvesiidappnodebalancertificationfukudomigawafukuis-a-democ" +
	"ratrentin-sudtirolfukumitsubishigakirovogradoyfukuokazakiryuohku" +
	"rafukuroishikarikaturindalfukusakisarazure-mobileirfjordfukuyama" +
	"gatakaharussiafunabashiriuchinadazaifudaigojomedicinaharimalbork" +
	"atowicefunagatakahashimamakishiwadafunahashikamiamakusatsumasend" +
	"aisennangonohejis-a-designerfundaciofunkfeuerfuoiskujukuriyamang" +
	"ooglecodespotrentin-sued-tirolfuosskoczowiiheyakumodernfurniture" +
	"ggio-calabriafurubirafurudonostiaafurukawairportland-4-salernodu" +
	"minamiizukaminokawanishiaizubangefusoftwarezzoologyfussagamihara" +
	"futabayamaguchinomihachimanagementrentin-suedtirolfutboldlygoing" +
	"nowhere-for-morenakasatsunairtelebitbridgestoneen-rootaruis-a-do" +
	"ctorfuttsurugimperiafuturecmshellaspeziafuturehostingfuturemaili" +
	"ngfvghangglidinghangoutsystemscloudsitehannanmokuizumodenakayama" +
	"nnorth-kazakhstanhannorthflankautokeinotairestaurantrentino-a-ad" +
	"igehanyuzenhapmircloudletshimojis-a-hard-workershimokawahappounz" +
	"enharstadharvestcelebrationhasamansionshimokitayamattelekommunik" +
	"ationhasaminami-alpshimonitayanagitappharmacyshimonosekikawahash" +
	"banghasudahasura-apphdfcbankazohasvikazteleportlligatrentino-aad" +
	"igehatoyamazakitahiroshimanxn--1lqs71dhatsukaichikaiseiyoichippu" +
	"betsubetsugarusrcfastlylbanzaicloudappspotagerhattfjelldalhayash" +
	"imamotobungotakadagestangeorgeorgiahazuminobusells-for-lesshimos" +
	"uwalkis-a-hunterhelsinkitakamiizumisanofidelitysvardontexistmein" +
	"-iservebeero-stagehembygdsforbundhemneshimotsukehemsedalhepforge" +
	"blockshimotsumayfirstockholmestrandherokusslattuminamimakis-a-kn" +
	"ightpointtohnoshoooshikamaishimodateheroyhgtvalleedaostehidorahi" +
	"gashiagatsumagoianiahigashichichibunkyonanaoshimakanegasakilatir" +
	"onthewifiatlassian-dev-myqnapcloudcontrolledogawarabikomaezakiru" +
	"nogiftshinichinanhigashihiroshimanehigashiizumozakitakatakanezaw" +
	"ahigashikagawahigashikagurasoedahigashikawakitaaikitakyushuaiahi" +
	"gashikurumeetrentino-alto-adigehigashimatsushimaoris-a-landscape" +
	"rugiahigashimatsuyamakitaakitadaitoigawahigashimurayamamotorcycl" +
	"eshinjournalismailillehammerfeste-iphiladelphiaareadmyblogsytehi" +
	"gashinarusells-for-ustkanmakitchenhigashinehigashiomitamamurausu" +
	"kitamihamadahigashiosakasayamanakakogawahigashishirakawamatakaok" +
	"almykiahigashisumiyoshikawaminamiaikitamotosumy-gatewayhigashits" +
	"unorthwesternmutualhigashiurawa-mazowszexnetrentino-altoadigehig" +
	"ashiyamatokoriyamanashifteditorxn--1qqw23ahigashiyodogawahigashi" +
	"yoshinogaris-a-lawyerhiraizumisatohmapartmentshinjukumamotoyamas" +
	"hikehirakatashinagawahiranairtrafficplexus-1hirarahiratsukaerutw" +
	"entehirayakagehistorichouseshinkamigototalhitachiomiyagildeskali" +
	"szhitachiotagophilatelyhitraeumtgeradegreehjartdalhjelmelandhole" +
	"ckochikushinonsenergyholidayhomegoodshinshinotsurgeonshalloffame" +
	"lbournehomeiphilipsynology-diskstationhomelinkyard-cloudjiffyres" +
	"dalhomelinuxn--2m4a15ehomeofficehomesecuritymacaparecidahomesecu" +
	"ritypchoyodobashichikashukujitawaravpagexlukowestus2homesenseeri" +
	"nghomesklepphoenixn--2scrj9christiansburgrondarhomeunixn--30rr7y" +
	"hondahongotembaixadahonjyoitakarazukaluganskazunoticeablevangerh" +
	"ornindalhorsells-itrentino-s-tirolhortendofinternet-dnshinshiroh" +
	"ospitalhoteleshintokushimahotelwithflightshintomikasaharahotmail" +
	"hoyangerhoylandetroitskddiamondshinyoshitomiokamishihoronobeauxa" +
	"rtsandcraftshiojirishirifujiedahumanitieshioyandexcloudhurdalhur" +
	"umajis-a-liberalhyllestadhyogoris-a-libertarianhyugawarahyundaiw" +
	"afuneis-uberleetrentino-sudtirolis-very-badajozis-a-painteractiv" +
	"estfoldis-very-evillageis-very-goodyearis-very-niceis-very-sweet" +
	"pepperis-with-thebandownloadisleofmanaustdaljenv-arubajddarchite" +
	"cturealtorlandjeonnamerikawauejetztrentino-sued-tiroljevnakershu" +
	"sdecorativeartshopwarendalenugjewelryjewishartgalleryjfkharkovao" +
	"jgorajlljls-sto1jls-sto2jls-sto3jmphxn--32vp30hadselburgjnjaworz" +
	"nosegawajoyentrentino-suedtiroljoyokaichibalashovhaebaruericsson" +
	"gdalenviknakatsugawajpnjprshoujis-a-personaltrainerjurkoshimizum" +
	"akiyosatokaizukamikoaniihamatamakawajimaritimoldell-ogliastrader" +
	"koshunantankhmelnitskiyamarugame-hostyhostingkosugekotohiradomai" +
	"nstitutekotourakouhokutamakiyosemitekounosupabasembokukiyosunnda" +
	"lkouyamarylhurstjordalshalsenkouzushimasfjordenkozagawakozakizun" +
	"okunimilitarykozowildlifestylekpnkppspdnshowtimeldalkrasnikahoku" +
	"tokamachintaifun-dnsaliashwilliamhillkrasnodarkredstonekrelliank" +
	"ristiansandcatsienarutolgakristiansundkrodsheradkrokstadelvalle-" +
	"aostatic-accessigdalkryminamioguni5kumanotogawakumatorinotteroyk" +
	"umejimashikis-a-republicancerresearchaeologicaliforniakumenantok" +
	"igawakunisakis-a-rockstarachowicekunitachiarailwaykunitomigusuku" +
	"leuvenetokashikis-a-socialistdlibestadkunneppuboliviajessheimper" +
	"trixcdn77-secureggiocalabriakunstsammlungkunstunddesignkuokgroup" +
	"ilotsilkhmelnytskyivaporcloudkuregruhostingkurgankurobeepilepsyk" +
	"kylvenicekurogimimatakatoris-a-soxfankuroisogndalkuromatsunais-a" +
	"-studentalkurotakikawasakis-a-teacherkassyno-dshiraois-a-linux-u" +
	"sershirahamatonbetsurgerykushirogawakustanais-a-techietis-a-llam" +
	"archeapigeelvinckfh-muensterkusuppliesimple-urlkutchanelverumina" +
	"misanrikubetsupplykutnovecoregontrailroadkuzumakis-a-therapistoi" +
	"akvafjordkvalsundkvamlidlugolekafjordvagsoygardendoftheinterneth" +
	"nologykvanangenkvinesdalkvinnheradkviteseidatingkvitsoykwpspectr" +
	"uminamitanekzmisakis-an-accountantshiraokamitondabayashiogamagor" +
	"iziamisasaguris-an-actormisawamisconfusedmishimassivegridmissile" +
	"wismillermisugitokorozawamitourismilezajskhplaystation-cloudyclu" +
	"stermitoyoakemiuramiyazurecontainerdpolicemiyotamanomjondalenmlb" +
	"fanmontrealestatefarmequipmentrentinoa-adigemonza-brianzapposird" +
	"almonza-e-della-brianzaptokuyamasudamonzabrianzaramonzaebrianzam" +
	"onzaedellabrianzamoonscaleforcemordoviamoriyamatsumaebashikshack" +
	"netrentinoaadigemoriyoshiminamiashigaramormonstermoroyamatsumoto" +
	"fukemortgagemoscowinbarclaycards3-external-1moseushistorymosjoen" +
	"moskeneslupsklabudhabikinokawabarthagakhanamigawamosslzmosvikmps" +
	"pbar2moteginowaniigatakahatakaishimogosenmoviemovimientokyotango" +
	"uvichungnamdalseidfjordynathomebuiltwithdarkarmoymozilla-iotrent" +
	"inoalto-adigemtranbymuginozawaonsenmuikaminoyamaxunispacemukoebe" +
	"nhavnmulhouservegame-servermunakatanemuncienciamuosattemupimient" +
	"aketomisatomobelementoraymurmansknx-serversicherungmurotorcraftr" +
	"entinoaltoadigemusashinoharamuseetrentinos-tirolmuseumvereniging" +
	"musicarbonia-iglesias-carboniaiglesiascarboniamutsuzawamy-vigorg" +
	"emy-wanggoupilemyactivedirectorymyasustor-elvdalmycdmycloudnsmol" +
	"arvikomaganemydattolocalhistorymyddnsgeekgalaxymydissentrentinos" +
	"tirolmydobisshikis-an-actresshiratakahagithubpreviewsaikisofukus" +
	"himangyshlakasamatsudopaashishikuis-a-musicianmydroboehringerike" +
	"mydsmushcdn77-sslingmyeffectrentinosud-tirolmyfastblogermyfirewa" +
	"llonieruchomoscienceandindustrynmyforuminamiuonumasoymyfritzmyft" +
	"paccessnoasakakinokiamyhome-servermyjinomykolaivarggatrentinosud" +
	"tirolmymailermymediapchurchaseljeepsondriodejaneirodoymyokohamam" +
	"atsudamypepinbarclays3-fips-us-gov-west-1mypetsokndalmyphotoshib" +
	"alatinombrendlyngeniwaizumiotsukumiyamazonawsglobalacceleratorah" +
	"imeshimabaridagawakuyachimataikikonaikawachinaganoharamcoachampi" +
	"onshiphoptobamadridnbloggerimo-siemenscaledekaasdaburmypictureso" +
	"larssonmypsxn--3ds443gmysecuritycamerakermyshopblocksolognemysho" +
	"pifymyspreadshoppingmythic-beastsolundbeckomakiyokawaramytis-a-b" +
	"ookkeeperspectakasakitashiobaramytuleap-partnersomamyvncircustom" +
	"er-ocimdbananarepublic66mywireitrentinosued-tirolplatterpioneerp" +
	"lazaplcube-serverplumbingoplurinacionalpodhalepodlasiellaktyubin" +
	"skiptveterinairealmpmnpodzonepohlpoivronpokerpokrovskommunalforb" +
	"undpoliticarrdpolitiendapolkowicepoltavalle-d-aostaticsopotrenti" +
	"nosuedtirolpomorzeszowindmillponpesaro-urbino-pesarourbinopesaro" +
	"masvuotnaritakoelnponypordenonepornporsangerporsangugeporsgrunna" +
	"nyokoshibahikariwanumatakinouepoznanpraxis-a-bruinsfanprdpresidi" +
	"oprgmrprimetelemarkommuneprincipeprivatizehealthinsuranceprofesi" +
	"onalprogressivestnesor-odalpromombetsupportrentinsud-tirolproper" +
	"typrotectionprotonetrentinsudtirolprudentialpruszkowindowskrakow" +
	"innersor-varangerprvcyberlevagangaviikanonjis-an-artistgstageprz" +
	"eworskogpugliapulawypupippueblockbusterniiminamiawajikis-an-anar" +
	"chistoricalsocietypvhagebostadpvtrentinsued-tirolpwcistrondheimm" +
	"obilienissayokkaichiropractichernovtsyncloudurbanamexhibitioniss" +
	"andiegomutashinainterhostsolutionsandoypythonanywherepaircraftin" +
	"gvollolipopittsburghofficialpzqldqotoyohashimotoolsorfoldqponiat" +
	"owadaqslgbtrentinsuedtirolqualifioappiwatequickconnectrentoyonak" +
	"agyokutoyakolobrzegersundquicksytesorocabalestrandabergamoarekey" +
	"machineustargardquipelementsorreisahayakawakamiichikawamisatotto" +
	"ris-an-engineeringqvcitadeliverydyndns-at-homedepotenzamamidorit" +
	"togitsumidatlantichirurgiens-dentistes-en-franceswidnikkokonoesw" +
	"iebodzin-dsldswiftcoverswinoujscienceandhistoryswissmarterthanyo" +
	"usynology-dsouthwest1-uslivinghistorytushuissier-justicetuvallea" +
	"ostaverntuxfamilytwmailvevelstadvibo-valentiavibovalentiavideovi" +
	"llasphinxn--3e0b707evinnicasacamdvrcampinagrandebuilderschmidtre" +
	"-gauldalvinnytsiavipsinaappixolinovirginiavirtual-userveexchange" +
	"virtualcloudvirtualservervirtualuserveftpizzavirtueeldomein-vigo" +
	"rlicevirtuelvisakegawaviterboknowsitallvivolkenkundenvixn--3hcrj" +
	"9civilisationisshingucciprianidyndns-at-workisboringrongausdalut" +
	"skarpaczeladzvlaanderenvladikavkazimierz-dolnyvladimirvlogintoyo" +
	"nezawavminanovologdanskongsvingervolvolkswagentspjelkavikomorots" +
	"ukagawavolyngdalvoorlopervossevangenvotevotingvotoyonovps-hostro" +
	"wiecivilizationiyodogawawithyoutuberspacekitagatargetmyipkomforb" +
	"arcelonagawalbrzycharternopilawalesundgcanonoichinomiyakehimejib" +
	"igawaustraliamuneues3-ap-south-1wiwatsukiyonortonwixsitewloclawe" +
	"konskowolayangroupiemontewmcloudwmflabsrhtrevisojamisonwnextdire" +
	"ctromsakatakkofuefukihabororosowawoodsideloittevaksdalworse-than" +
	"dawowiospydebergwpdevcloudwpenginepoweredwphostedmailwpmucdnplan" +
	"tsomnarviikamiokameokamakurazakitaurawpmudeveloperauniterois-cer" +
	"tifiedunetlifyis-a-nascarfanwritesthisblogwroclawitdkoninjambylw" +
	"tcirclerkstagets-itromsokamogawawtfastvps-serveronakanotoddenwuo" +
	"zuwzmiuwajimaxn--45brj9civilwarmiasakuchinotsuchiurakawatchandcl" +
	"ockaruizawaxn--45q11clanbibaidarmeniaxn--4gbriminingxn--4it168dx" +
	"n--4it797konyvelohmusashimurayamarylandxn--4pvxs4allxn--54b7fta0" +
	"ccldmailuxuryxn--55qw42gxn--55qx5dxn--5js045dxn--5rtp49cleverapp" +
	"stmnxn--5rtq34kooris-a-photographerokuapphotographysioxn--5su34j" +
	"936bgsgxn--5tzm5gxn--6btw5axn--6frz82gxn--6orx2rxn--6qq986b3xlxn" +
	"--7t0a264clic20001wwwfarmsteadyndns-blogdnsanfranciscofreakunemu" +
	"rorangecloudplatform0xn--80aaa0cvacationsrlxn--80adxhksrvaroyxn-" +
	"-80ao21axn--80aqecdr1axn--80asehdbarefootballooningjovikaraganda" +
	"ustrheimatunduhrennesoyokosukanramusementdllclstagehirnrtatarant" +
	"ours3-ap-southeast-1xn--80aswgxn--80augustowithgoogleapiszxn--8l" +
	"tr62kopervikhersonxn--8pvr4uxn--8y0a063axn--90a1aflakstadaokagak" +
	"icks-assnasaarlandxn--90a3academiamicable-modemoneyxn--90aeropor" +
	"talaheadjudaicadaquestorebaselectritonxn--90aishobarakawagoexn--" +
	"90amcdirxn--90azhytomyravendbargainstancempresashibetsukuibmdisc" +
	"ourses3-sa-east-1xn--9dbhblg6dietrusteexn--9dbq2axn--9et52uxn--9" +
	"krt00axn--andy-iraxn--aroport-byaotsurnadalxn--asky-iraxn--aursk" +
	"og-hland-jnbarreauctionfabricafjs3-us-east-2xn--avery-yuasakuhok" +
	"ksundxn--b-5gaxn--b4w605ferdxn--balsan-sdtirol-nsbstorfjordxn--b" +
	"ck1b9a5dre4clicketcloudcontrolappgafanxn--bdddj-mrabdxn--bearalv" +
	"hki-y4axn--berlevg-jxaxn--bhcavuotna-s4axn--bhccavuotna-k7axn--b" +
	"idr-5nachikatsuuraxn--bievt-0qa2xn--bjarky-fyasakaiminatoyookana" +
	"zawaxn--bjddar-ptarnobrzegyptianxn--blt-elabourxn--bmlo-grainger" +
	"xn--bod-2natalxn--bozen-sdtirol-2obanazawaxn--brnny-wuacademy-fi" +
	"rewall-gatewayxn--brnnysund-m8accident-investigation-aptibleadpa" +
	"gesquare7xn--brum-voagatrvestre-slidreportrogstadxn--btsfjord-9z" +
	"axn--bulsan-sdtirol-nsbarrel-of-knowledgeappleborkarasjohkameyam" +
	"atotakadauthgear-stagingjesdalimanowarudaukraanghkembuchikumagay" +
	"agawakepnoipirangalsaceobiragrocerybnikeisenbahnatuurwetenschapp" +
	"engineastcoastaldefenceastus2xn--c1avgxn--c2br7gxn--c3s14mincomc" +
	"astresindevicenzaporizhzhiaxn--cck2b3barrell-of-knowledgecompute" +
	"rhistoryofscience-fictionredumbrellaakesvuemieleccemrxn--cckwcxe" +
	"tdxn--cesena-forl-mcbremangerxn--cesenaforl-i8axn--cg4bkis-found" +
	"ationxn--ciqpnxn--clchc0ea0b2g2a9gcdxn--comunicaes-v6a2oxn--corr" +
	"eios-e-telecomunicaes-ghc29axn--czr694barsycenterprisesakikuchik" +
	"useihicampobassociatest-iservecounterstrikeu-1xn--czrs0try-snowp" +
	"lowiczest-le-patronxn--czru2dxn--czrw28barsyonlinewhampshirealty" +
	"dalpha-myqnapcloud66xn--d1acj3basicservercelliguriauthgearappspa" +
	"cehosted-by-previderhclouddnslivefsnillfjorddnss3-ca-central-1xn" +
	"--d1alfaromeoxn--d1atrycloudflareplantationxn--d5qv7z876clickris" +
	"inglesangoxn--davvenjrga-y4axn--djrs72d6uyxn--djty4koryokamikawa" +
	"nehonbetsurutaharaxn--dnna-grajewolterskluwerxn--drbak-wuaxn--dy" +
	"ry-iraxn--e1a4clinichitachinakagawassamukawatarikuzentakatairave" +
	"nnagasakimobetsuldaluccaravantaarparmatsuuraxn--eckvdtc9dxn--efv" +
	"n9storjcloud-ver-jpchristmasakinderoyxn--efvy88haibarakitahataka" +
	"nabeautysfjordxn--ehqz56nxn--elqq16hair-surveillancexn--eveni-0q" +
	"a01gaxn--f6qx53axn--fct429kosaigawaxn--fhbeiarnxn--finny-yuaxn--" +
	"fiq228c5hstpetersburgxn--fiq64basilicataniauthordalandds3-eu-cen" +
	"tral-1xn--fiqs8streamscompute-1xn--fiqz9studioxn--fjord-lraxn--f" +
	"jq720axn--fl-ziaxn--flor-jraxn--flw351exn--forl-cesena-fcbsstudy" +
	"namisches-dnsortlandxn--forlcesena-c8axn--fpcrj9c3dxn--frde-gran" +
	"drapidstuff-4-salexn--frna-woaraisaijosoyrovigotsukisosakitagawa" +
	"xn--frya-hraxn--fzc2c9e2cliniquedapliernewyorkshirebungoonordest" +
	"e-idchitosetoeigersundurhamburgroks-thisayamanobeokakegawaxn--fz" +
	"ys8d69uvgmailxn--g2xx48clintonoshoesanjotelulubindaluzernxn--gck" +
	"r3f0fauskedsmokorsetagayaseralingenoamishirasatogliattis-a-celti" +
	"csfanxn--gecrj9clothingdustdatadetectksatxn--12c1fe0bradescotlan" +
	"dyndns-freeboxosascoli-picenordkapparochernigovernmentlon-2xn--g" +
	"gaviika-8ya47hakatanorfolkebibleksvikatsushikabeebyteapplinzis-a" +
	"-financialadvisor-aurdalxn--gildeskl-g0axn--givuotna-8yasugitlab" +
	"orxn--gjvik-wuaxn--gk3at1exn--gls-elacaixaxn--gmq050is-gonexn--g" +
	"mqw5axn--gnstigbestellen-zvbrplsbxn--3oq18vl8pn36axn--gnstiglief" +
	"ern-wobihirosakikamijimatsusakahoginankokubunjis-into-animegurow" +
	"nproviderxn--h-2failxn--h1aeghakodatexn--h1ahnxn--h1alizxn--h2br" +
	"eg3evenestufftoread-booksnesoruminamiyamashirokawanabelaudibleas" +
	"ingxn--h2brj9c8cn-northwest-1xn--h3cuzk1discountysnestuttgartroa" +
	"ndinosaurepbodynamic-dnsoundcastronomy-routerxn--hbmer-xqaxn--hc" +
	"esuolo-7ya35basketballfinanzgorzeleccogladedyn-berlincolnavigati" +
	"onavoizumizakiitatebayashiibahccavuotnagaraholtalenglandiscovery" +
	"ggeeu-2xn--hery-iraxn--hgebostad-g3axn--hkkinen-5waxn--hmmrfeast" +
	"a-s4accident-prevention-k3surreyxn--hnefoss-q1axn--hobl-iraxn--h" +
	"oltlen-hxaxn--hpmir-xqaxn--hxt814exn--hyanger-q1axn--hylandet-54" +
	"axn--i1b6b1a6a2exn--imr513nxn--indery-fyasuokannamiharuxn--io0a7" +
	"is-into-carshisohugheshisuifuelluciancrmrecruitrentino-stirolxn-" +
	"-j1adplatformshangrilaquilanxessooxn--j1aefbsbxn--1ck2e1bar0emma" +
	"fann-arboretumbriamallamaceiobbcg12038xn--j1ael8batochiokinoshim" +
	"aizurugbyglandroverhallahppiacenzachpomorskienavuotnapleskns3-us" +
	"-gov-west-1xn--j1amhakonexn--j6w193gxn--jlq480n2rgxn--jlq61u9w7b" +
	"atsfjordishakotanayorovnobserverxn--jlster-byatominamidaitomanch" +
	"esterxn--jrpeland-54axn--jvr189miniserverxn--k7yn95exn--karmy-yu" +
	"axn--kbrq7oxn--kcrx77d1x4axn--kfjord-iuaxn--klbu-woaxn--klt787dx" +
	"n--kltp7dxn--kltx9axn--klty5xn--3pxu8konsulatrobeeldengeluidvare" +
	"servdxn--koluokta-7ya57hakubahcavuotnagaivuotnagaokakyotambabydg" +
	"oszczecinemagnetnedalipaywhirlxn--kprw13dxn--kpry57dxn--kput3is-" +
	"into-cartoonshitaramaxn--krager-gyatsukanoyaltakashimarnardalxn-" +
	"-kranghke-b0axn--krdsherad-m8axn--krehamn-dxaxn--krjohka-hwab49j" +
	"devcloudfunctionshizukuishimofusaitoshimatsuzakis-a-patsfanxn--k" +
	"snes-uuaxn--kvfjord-nxaxn--kvitsy-fyatsushiroxn--kvnangen-k0axn-" +
	"-l-1fairwindsusakis-an-entertainerxn--l1accentureklamborghinikol" +
	"aeventsusonoxn--laheadju-7yawaraxn--langevg-jxaxn--lcvr32dxn--ld" +
	"ingen-q1axn--leagaviika-52bauhauspostman-echocolatemasekd1xn--le" +
	"sund-huaxn--lgbbat1ad8jdfaststacksaves-the-whalessandria-trani-b" +
	"arletta-andriatranibarlettaandriaxn--lgrd-poacctrysiljanxn--lhpp" +
	"i-xqaxn--linds-pramericanartunespeedpartnerxn--lns-qlavagiskexn-" +
	"-loabt-0qaxn--lrdal-sraxn--lrenskog-54axn--lt-liacngrossetouchih" +
	"ayaakasakawaharaxn--lten-granexn--lury-iraxn--m3ch0j3axn--mely-i" +
	"raxn--merker-kuaxn--mgb2ddesuzakanagawaxn--mgb9awbfbx-oslocuscou" +
	"ntryestateofdelawareclaimsavonarusawaxn--mgba3a3ejtunkongsbergxn" +
	"--mgba3a4f16axn--mgba3a4fra1-deltaitogakushimotoganexn--mgba7c0b" +
	"bn0axn--mgbaakc7dvfbxostrowwlkpmguovdageaidnulvikashiwazakiwielu" +
	"nnerxn--mgbaam7a8hakuis-a-geekatsuyamarshallstatebankaufentigerx" +
	"n--mgbab2bdxn--mgbah1a3hjkrdxn--mgbai9a5eva00bellunord-aurdalvda" +
	"laskanittedallasalleangaviikadenagahamaroyerxn--mgbai9azgqp6jeju" +
	"niperxn--mgbayh7gpalermomahachijolsterxn--mgbbh1a71exn--mgbc0a9a" +
	"zcgxn--mgbca7dzdoxn--mgbcpq6gpa1axn--mgberp4a5d4a87gxn--mgberp4a" +
	"5d4arxn--mgbgu82axn--mgbi4ecexposedxn--mgbpl2fhskypexn--mgbqly7c" +
	"0a67fbcnpyatigorskolecznagasukexn--mgbqly7cvafr-1xn--mgbt3dhdxn-" +
	"-mgbtf8flapymnturystykaneyamazoexn--mgbtx2beneventodayombolzano-" +
	"altoadigeologyomitanoceanographiqueu-3xn--mgbx4cd0abbvieeexn--mi" +
	"x082fedorainfraclouderaxn--mix891fedorapeoplegallodingenxn--mjnd" +
	"alen-64axn--mk0axin-the-bandais-into-gamessinazawaxn--mk1bu44cns" +
	"annanxn--mkru45is-leetrentino-sud-tirolxn--mlatvuopmi-s4axn--mli" +
	"-tlavangenxn--mlselv-iuaxn--moreke-juaxn--mori-qsakuragawaxn--mo" +
	"sjen-eyawatahamaxn--mot-tlazioxn--mre-og-romsdal-qqbuseranishiar" +
	"itakurashikis-lostre-toteneis-a-nursellsyourhomeftphonefosshirak" +
	"okamiminershiranukamisunagawaxn--msy-ula0hakusanagochijiwadefini" +
	"mamateramochizukinkobierzycexn--mtta-vrjjat-k7afedoraprojectozsd" +
	"elmenhorstalbansaxoxn--muost-0qaxn--mxtq1minisitexn--ngbc5azdxn-" +
	"-ngbe9e0axn--ngbrxn--41axn--nit225kosakaerodromegallupaascolipic" +
	"eno-ipifony-1xn--nmesjevuemie-tcbalsan-sudtirollagdenesnaaseinet" +
	"-freaksuzukananiikappudoxn--nnx388axn--nodessakurais-not-certifi" +
	"edxn--nqv7fs00emaxn--nry-yla5gxn--ntso0iqx3axn--ntsq17gxn--ntter" +
	"y-byaeservehalflifeinsurancexn--nvuotna-hwaxn--nyqy26axn--o1ache" +
	"rnihivgubsuzukis-bytomaritimekeepingxn--o3cw4haldenxn--o3cyx2axn" +
	"--od0algxn--od0aq3bentleyonagoyautomotivelandeportexasnesoddenma" +
	"rkhangelskjakdnepropetrovskiervaapsteiermarkanzakiwakunigamihokk" +
	"aidovre-eikerxn--ogbpf8flatangerxn--oppegrd-ixaxn--ostery-fyaxn-" +
	"-osyro-wuaxn--otu796dxn--p1acfeiraquarelleaseeklogeschokokekscho" +
	"koladenxn--p1ais-savedxn--pgbs0dhlx3xn--porsgu-sta26fermockasser" +
	"versaillescholarshipschoolsztynsettsurfashionxn--pssu33lxn--pssy" +
	"2uxn--q7ce6axn--q9jyb4cntmparsannohelplfinancialvivanovoldaxn--q" +
	"cka1pmckinseyxn--qqqt11minnesotaketakayamassa-carrara-massacarra" +
	"ramassabusinessebykleclerchromediatechnologyxn--qxa6axn--qxamste" +
	"rdamnserverbaniaxn--rady-iraxn--rdal-poaxn--rde-ulaxn--rdy-0naba" +
	"ris-slickhakassiaxn--rennesy-v1axn--rhkkervju-01aferraraxn--rhol" +
	"t-mragowoltlab-democraciaxn--rhqv96gxn--rht27zxn--rht3dxn--rht61" +
	"exn--risa-5naturalhistorymuseumcenterxn--risr-iraxn--rland-uuaxn" +
	"--rlingen-mxaxn--rmskog-byaxn--rny31halsaitamatsukuris-a-greenxn" +
	"--rovu88beppublishproxyonagunicloudiskussionsbereichattanooganor" +
	"ddalimitedisrechtranakaiwamizawawsmpplanetariumcpreservationfsho" +
	"strodawarautoscanadaeguambulancentralus-2xn--rros-granvindafjord" +
	"xn--rskog-uuaxn--rst-0naturalsciencesnaturellesvalbardunloppacif" +
	"icitichiryukyuragifuchungbukharaumalatvuopmicrosoftbankariyamein" +
	"forumzxn--rsta-framercanvasvcivilaviationissedaluroyxn--rvc1e0am" +
	"3exn--ryken-vuaxn--ryrvik-byaxn--s-1faithammarfeastafricapitalon" +
	"ewspaperxn--s9brj9collectionxn--sandnessjen-ogbeskidyn-ip24lima-" +
	"cityeatselinogradimo-i-rana4u2-localhostrolekaniepce12hpalmasera" +
	"ti234xn--sandy-yuaxn--sdtirol-n2axn--seral-lraxn--ses554gxn--sgn" +
	"e-graphoxn--42c2d9axn--skierv-utazasveioxn--skjervy-v1axn--skjk-" +
	"soaxn--sknit-yqaxn--sknland-fxaxn--slat-5naturbruksgymnxn--slt-e" +
	"labcieszynh-serveblogspotaribeiraogakibichuoxn--smla-hraxn--smna" +
	"-gratangentlentapisa-geekoseis-a-playershiftcryptonomichigangwon" +
	"xn--snase-nraxn--sndre-land-0cbestbuyshouses3-us-west-1xn--snes-" +
	"poaxn--snsa-roaxn--sr-aurdal-l8axn--sr-fron-q1axn--sr-odal-q1axn" +
	"--sr-varanger-ggbetainaboxfusejnyanagawalmartattoolforgerockartu" +
	"zyoriikarasjokarasuyamarriottaxihuanhlfanhs3-us-west-2xn--srfold" +
	"-byaxn--srreisa-q1axn--srum-gratis-a-bulls-fanxn--stfold-9xaxn--" +
	"stjrdal-s1axn--stjrdalshalsen-sqbhzcasadelamonedanceu-4xn--stre-" +
	"toten-zcbieidskoguchikuzenikonanporocelotenkawaveroykenflfanpach" +
	"igasakids3-eu-west-1xn--t60b56axn--tckwebthingsvelvikomvuxn--3bs" +
	"t00minamiminowaxn--tiq49xqyjelasticbeanstalkharkivanylvenneslask" +
	"errylogisticshizuokamitsuexn--tjme-hraxn--tn0agrinetbankosherbro" +
	"okegawaxn--tnsberg-q1axn--tor131oxn--trany-yuaxn--trentin-sd-tir" +
	"ol-rzbielawaltervistainaioirasebastopologyeongnamegawafaicloudin" +
	"eat-urlimoliseminevje-og-hornnes3-website-ap-northeast-1xn--tren" +
	"tin-sdtirol-7vbiellair-traffic-controlleyoshiokanumazuryukiiyama" +
	"nouchikuhokuryugasakitanakagusukumodumeloyalistoragextraspace-to" +
	"-rentalstomakomaibaravocatanzarowbq-aurskog-holandingivingjemnes" +
	"3-ap-southeast-2xn--trentino-sd-tirol-c3bieszczadygeyachiyodaeje" +
	"onbukcoalwaysdatabaseballangenkainanaejrietisalatinabenonicbcn-n" +
	"orth-1xn--trentino-sdtirol-szbievat-band-campaniavoues3-eu-west-" +
	"2xn--trentinosd-tirol-rzbifukagawashingtondclk3xn--trentinosdtir" +
	"ol-7vbigv-infolldalivornow-dns3-website-ap-southeast-1xn--trenti" +
	"nsd-tirol-6vbihorologyukuhashimoichinosekigaharaxarnetflixilovec" +
	"ollegefantasyleaguernseyokotebetsuikirkenes3-eu-west-3utilities-" +
	"1xn--trentinsdtirol-nsbikedaemonmoutheworkpccweddinglassassinati" +
	"onalheritagexn--trgstad-r1axn--trna-woaxn--troms-zuaxn--tysvr-vr" +
	"axn--uc0atvestre-totennishiawakuraxn--uc0ay4axn--uist22hamurakam" +
	"igoris-a-gurunusualpersonxn--uisz3gxn--unjrga-rtarumizusawaxn--u" +
	"nup4yxn--uuwu58axn--vads-jraxn--valle-aoste-ebbtuscanyxn--valle-" +
	"d-aoste-ehbodoes-itcouldbeworldxn--valleaoste-e7axn--valledaoste" +
	"-ebbvadsoccertmgrazerbaijan-mayengerdalcesvizzeraxn--vard-jraxn-" +
	"-vegrshei-c0axn--vermgensberater-ctbitsvn-reposouthcarolinarviko" +
	"monoticiashowaxn--vermgensberatung-pwblogoiplatter-appinkomatsus" +
	"himarumorimachidaxn--vestvgy-ixa6oxn--vg-yiabkhaziaxn--vgan-qoax" +
	"n--vgsy-qoa0jelenia-goraxn--vgu402colognexus-3xn--vhquvestvagoyx" +
	"n--vler-qoaxn--vre-eiker-k8axn--vrggt-xqadxn--vry-yla5gxn--vuq86" +
	"1bilbaokinawashirosatobishimagentositecnologiazurewebsiteshikaga" +
	"miishibukawakkanaibetsubamericanfamilydsmynasushiobarackmazeplay" +
	"okozebinagisochildrensgardenaval-d-aosta-valleyolasitebinordland" +
	"evelopmentatsunobninskaracoldwarszawaustevollillyboltateshinanom" +
	"achimkentateyamajudygarlanddnskingitpagefrontappalmspringsakeret" +
	"rosnubaltimore-og-romsdalp1xn--w4r85el8fhu5dnraxn--w4rs40lxn--wc" +
	"vs22dxn--wgbh1colonialwilliamsburgroundhandlingroznyxn--wgbl6axn" +
	"--xhq521billustrationrenderxn--xkc2al3hye2axn--xkc2dl3a5ee0hands" +
	"onyxn--y9a3aquariumintereisenxn--yer-znaturhistorischeswidnicart" +
	"oonartdecologiaxn--yfro4i67oxn--ygarden-p1axn--ygbi2ammxn--45br5" +
	"cylxn--ystre-slidre-ujbiocpanamatsushigexn--zbx025dxn--zf0ao64ax" +
	"n--zf0avxlxn--zfr164bipanasonicasertaipeidsvollombardiadembetsuk" +

// nodes is the list of nodes. Each node is represented as a uint32, which
// encodes the node's children, wildcard bit and node type (as an index into
// the children array), ICANN bit and text.
// If the table was generated with the -comments flag, there is a //-comment
// after each node's data. In it is the nodes-array indexes of the children,
// formatted as (n0x1234-n0x1256), with * denoting the wildcard bit. The
// nodeType is printed as + for normal, ! for exception, and o for parent-only
// nodes that have children but don't match a domain label in their own right.
// An I denotes an ICANN domain.
// The layout within the uint32, from MSB to LSB, is:
//	[ 0 bits] unused
//	[10 bits] children index
//	[ 1 bits] ICANN bit
//	[15 bits] text index
//	[ 6 bits] text length
var nodes = [...]uint32{
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
ale's avatar
ale committed
For faster browsing, not all history is shown. View entire blame